OL143_MOUSE P34985
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P34985
Recommended name：Olfactory receptor 143
EC number：
Alternative names：(Odorant receptor K18) (Olfactory receptor 170-6) (Olfactory receptor 7A)
Cleaved into：
GeneID：
Gene names (primary )：Olfr143
Gene names (synonym )：Mor170-6 Olfr7
Gene names (ORF )：
Length：313
Mass：35201
Sequence：MMQITMENKSSVSEFILMGLTDQPELQLPLFVLFLMNYTATVMGNLTLMNLICLNSNLHTPMYFFLFNLSFIDFCYSMVFTPKMLMSFILEKNTISFGGCMAQLFFFLFFVNSESYVLTAMAYDRYVAICKPLTYKVIMSPKICCLLIFSSYLMGFASAMAHTGCMIRLSFCDSNIINHYMCDIFPLLPLSCSSTYVNELMSSVVVGSAIILCCLIILISYAMILFNIIHMSSGKGWSKALGTCGSHIITVSLFYGSGLLAYVKPSSAKTVGQGKFFSVFYTLLVPMLNPLIYSLRNKDVKLAVKKTWKRITS
Tissue specificity：Olfactory epithelium.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family