MK67I_MOUSE   Q91VE6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91VE6

Recommended name:MKI67 FHA domain-interacting nucleolar phosphoprotein

EC number:

Alternative names:(Nucleolar protein interacting with the FHA domain of pKI-67) (mNIFK)

Cleaved into:

GeneID:67949

Gene names  (primary ):Nifk

Gene names  (synonym ):Mki67ip

Gene names  (ORF ):

Length:317

Mass:36265

Sequence:MAGLAGPAKPSLALNPQEDSQFEKALTQIQGRTKKPQQKKKEKLNRGVVYLGHLPSTLSESHIYNYCAQFGDISRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMDNYLFGERLLSCKFMPRKKVHKDLFSQRNALFHRPSFPAVKRYNRKRGHLQMLKMEYRFKKKEKLLRKKLAAKGIDYSFPSLVLPKPKNIAVAHRDSEGNQVLPDQKEGLSGEPRRKEKMMKEDISNNIPKKRKRSRRKKSSVDSQGPTPVCTPTFLERRKSQVMEVGGDKDDEIILKLPVPPVKEDTQKTPTSASPGGKRPRKRKSKQ

Tissue specificity:Expressed in brain, heart, hind limb muscles, intestine, liver, skin and spleen. {ECO:0000269|PubMed:12798774}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp