ENTP7_MOUSE Q3TCT4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3TCT4
Recommended name：Ectonucleoside triphosphate diphosphohydrolase 7
EC number：EC 3.6.1.-
Alternative names：(NTPDase 7) (Lysosomal apyrase-like protein 1)
Cleaved into：
GeneID：93685
Gene names (primary )：Entpd7
Gene names (synonym )：Kiaa4066 Lalp1
Gene names (ORF )：
Length：606
Mass：68974
Sequence：MARISFSYLCPASWYFTVPTVSPFLRQRVAFLGLFFIPCVLLLLLIMDLRHWATSLPRDRQYERYLARVGDLEATNTEDPNLNYGLVVDCGSSGSRIFVYFWPRHNGNPHDLLDIKQMRDRNSQPVVKKIKPGISAMADTPEHASDYLRPLLSFAAAHVPVKKHRETPLYILCTAGMRLLPERQQLAILADLVKDLPLEFDFLFSQSQAEVISGKQEGVYAWIGINFVLGRFDHEDESDSDTSVDSAAGRRRTVGILDMGGASLQIAYEVPTSASDLPPKQEEAAKILLAEFNLGCDVQHTEHVYRVYVTTFLGFGGNFARQRYEDLVLNETLNKNRLLGQKTGLSPDNPFLDPCLPVGLTDMVKRNNQVLHFRGKGDWASCRTLLSPLLARSNTSQASLNGIYQSPIDFNNSEFYGFSEFFYCTEDVLRIGGHYHGPTFAKAAQDYCGMAWPVLAQRFKNGLFSSHADEHRLKYQCFKSAWMYEVLHEGFHFPYDYPNLQTAQLVYDREVQWTLGAILYKTRFLPLRDLRQGQGGVRPAHGSWLRLSFVYNHYLFFACTLVVLLAIVLYLLRIHRIHRRQTRASAPLDLLWIEQVVPMIGVQVGP
Tissue specificity：Widely expressed. Expressed at high level in brain, kidney, liver and testis. Weakly expressed in lung, thymus and heart. {ECO:0000269|PubMed:11278936}.
Induction：
Developmental stage：
Protein families：GDA1/CD39 NTPase family