NRL_MOUSE   P54846


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P54846

Recommended name:Neural retina-specific leucine zipper protein

EC number:

Alternative names:(NRL)

Cleaved into:

GeneID:18185

Gene names  (primary ):Nrl

Gene names  (synonym ):

Gene names  (ORF ):

Length:237

Mass:26083

Sequence:MAFPPSPLAMEYVNDFDLMKFEIKREPSEGRSGVPTASLGSTPYSSVPPSPTFSEPGMVGGGEAPRPGLEELYWLATLQQQLGSDEVLGLSPDEAVELLQNQGPVSMEGPLGYYSGSPGETGAQHVQLPERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSGGPGSDDHTHLFL

Tissue specificity:Expressed in the retina (at protein level) (PubMed:11477108). {ECO:0000269|PubMed:11477108}.

Induction:

Developmental stage:

Protein families:BZIP family


   💬 WhatsApp