NPY4R_MOUSE   Q61041


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q61041

Recommended name:Neuropeptide Y receptor type 4

EC number:

Alternative names:(NPY4-R) (NPYR-D) (Pancreatic polypeptide receptor 1) (PP1)

Cleaved into:

GeneID:19065

Gene names  (primary ):Npy4r

Gene names  (synonym ):Ppyr1

Gene names  (ORF ):

Length:375

Mass:42648

Sequence:MNTSHFLAPLFPGSLQGKNGTNPLDSPYNFSDGCQDSAELLAFIITTYSIETILGVLGNLCLIFVTTRQKEKSNVTNLLIANLAFSDFLMCLICQPLTVTYTIMDYWIFGEVLCKMLTFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSIFQAYLGIVVIWFVSCFLSLPFLANSTLNDLFHYNHSKVVEFLEDKVVCFVSWSSDHHRLIYTTFLLLFQYCIPLAFILVCYIRIYQRLQRQKHVFHAHACSSRAGQMKRINSMLMTMVTAFAVLWLPLHVFNTLEDWYQEAIPACHGNLIFLMCHLLAMASTCVNPFIYGFLNINFKKDIKALVLTCHCRSPRGESEHLPLSTVHTDLSKGSMRMGSKSNFI

Tissue specificity:Heart, detected in small intestine. {ECO:0000269|PubMed:8641440}.

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp