NPM_MOUSE   Q61937


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q61937

Recommended name:Nucleophosmin

EC number:

Alternative names:(NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin)

Cleaved into:

GeneID:18148

Gene names  (primary ):Npm1

Gene names  (synonym ):

Gene names  (ORF ):

Length:292

Mass:32560

Sequence:MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Tissue specificity:Expressed in B-cells that have been induced to switch to various Ig isotypes. {ECO:0000269|PubMed:9642267}.

Induction:

Developmental stage:

Protein families:Nucleoplasmin family


   💬 WhatsApp