NSE3_MOUSE   Q9CPR8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CPR8

Recommended name:Non-structural maintenance of chromosomes element 3 homolog

EC number:

Alternative names:(Non-SMC element 3 homolog) (MAGE-G1 antigen) (Necdin-like protein 2)

Cleaved into:

GeneID:66647

Gene names  (primary ):Nsmce3

Gene names  (synonym ):Mageg1 Ndnl2

Gene names  (ORF ):

Length:279

Mass:31460

Sequence:MLQKPRGRGRPSTQADPERDWGGAGEEGPSTSRAAGGSSQGSRASLSAPTVGPRTQKQLELKVAELVQFLLIKDQKKIPIKRTDILKHVVGDYRDVYPNLLKLAAERLQYVFGYKLVELEPKSHSYILINMLEPVEADAEMRGDQGTPISGLLMIVLGLIFMKGNTITETEVWDFLRRLGVYPTKKHLIFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYELQWGPRTNLETSKMKVLKFVAKVHNQDPKDWPTQYCEALADEESRARPATASAPATSS

Tissue specificity:Ubiquitous. {ECO:0000269|PubMed:11782285, ECO:0000269|PubMed:14593116}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp