VMP1_MOUSE   Q99KU0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99KU0

Recommended name:Vacuole membrane protein 1

EC number:

Alternative names:(NF-E2-inducible protein 2) (Protein ni-2) (Transmembrane protein 49)

Cleaved into:

GeneID:75909

Gene names  (primary ):Vmp1

Gene names  (synonym ):Tmem49

Gene names  (ORF ):

Length:406

Mass:45960

Sequence:MAENGKNCDQRRIAMSKDQHNGSLTDPSSVHEKKRRDREERQNIVLWRQPLITLQYFSLETLVVLKEWTSKLWHRQSIVVSFLLLLAALVATYYVEGAHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPEEEGAEGAISLWSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAEAAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIVTFSKHIVEQMVTFIGAVPGIGPSLQKPFQEYLEAQRQKLHHRSEAGTPQGENWLSWMFEKLVVAMVCYFVLSIINSMAQNYAKRIQQRLNSEEKTK

Tissue specificity:

Induction:

Developmental stage:

Protein families:VMP1 family


   💬 WhatsApp