NRIP2_MOUSE   Q9JHR9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JHR9

Recommended name:Nuclear receptor-interacting protein 2

EC number:

Alternative names:(Neuronal-interacting factor X 1)

Cleaved into:

GeneID:60345

Gene names  (primary ):Nrip2

Gene names  (synonym ):Nix1

Gene names  (ORF ):

Length:270

Mass:29284

Sequence:MSTGQEARRDEGDSRKEQEASLRDRAHLSQQRQLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPHSVIQRRLVEGNQRRLQGESPLLQALIRGHDSSRTSATQVPALLVNCKCQDQMLRVAVDTGTQHNQISAGCLRRLGLGKRVPKAPGGDVAPEPPTQVEQLELELGQETVACSAQVVDVDSPEFCLGLQTLLSLKLATSLSASSLLPSALGIPTESICDSEALVPHSLLSLPKCTTKSLTEKDLQQMGSRLHPGCRGQSYLLPPLA

Tissue specificity:Expression is restricted to the central nervous system (neurons in the dentate gyrus of the hippocampus, the amygdala, thalamic and hypothalamic regions). {ECO:0000269|PubMed:10860982}.

Induction:

Developmental stage:

Protein families: