CCG5_MOUSE Q8VHW4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VHW4
Recommended name：Voltage-dependent calcium channel gamma-5 subunit
EC number：
Alternative names：(Neuronal voltage-gated calcium channel gamma-5 subunit) (Transmembrane AMPAR regulatory protein gamma-5) (TARP gamma-5)
Cleaved into：
GeneID：140723
Gene names (primary )：Cacng5
Gene names (synonym )：
Gene names (ORF )：
Length：275
Mass：30894
Sequence：MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGIILPQNQSTEVKMSLHSGLWRVCFLAGEERGRCFTIEYVMPMNSQMTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWIRGRSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC
Tissue specificity：Brain. Enriched in Bergman glia, as well as a variety of neuronal populations including locus coeruleus, olfactory bulb, lateral septal nucleus, interpeduncular nucleus, and the CA2 and rostral/medial CA1 regions of hippocampus. {ECO:0000269|PubMed:18817736}.
Induction：
Developmental stage：
Protein families：PMP-22/EMP/MP20 family, CACNG subfamily