TM11C_MOUSE   Q1JRP2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q1JRP2

Recommended name:Transmembrane protease serine 11C

EC number:EC 3.4.21.-

Alternative names:(Neurobin)

Cleaved into:Transmembrane protease serine 11C non-catalytic chain; Transmembrane protease serine 11C catalytic chain

GeneID:435845

Gene names  (primary ):Tmprss11c

Gene names  (synonym ):

Gene names  (ORF ):

Length:431

Mass:48073

Sequence:MARGQPRRSEEQWTALQNRTECKTKIKLTRCGKITLGILTAVLAAVLIGLIAYFAACGKDSFYYHVSFKVNNIDYDSKFAKPYSQEYMDLNKRIVSLMNETFHESKLRKQYVKAHTVQVSKAKGKVVIHAVLKFKACYRNNVEKYWESVETTLYQKLKGQTGLLIDSSSFKFSDIAMPIAEDLLNTCCGRRTIIHRGHKVAGGQDAEEGEWPWQASLQQNSVHRCGATLISNYWLITAAHCFIRAANPKDWKVSFGFLLSKPQAPRAVKNIIIHENYSYPAHDNDIAVVRLSSPVLYESNIRRACLPEATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGKVKIIDNKTCNSGKAYGGMITPGMMCAGFLKGRVDACQGDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTYYRDWITSKTGL

Tissue specificity:Expressed specifically in Purkinje neurons of the cerebellum (at protein level). Also detected in spinal cord. {ECO:0000269|PubMed:18215125}.

Induction:

Developmental stage:

Protein families:Peptidase S1 family


   💬 WhatsApp