EMC8_MOUSE   O70378


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O70378

Recommended name:ER membrane protein complex subunit 8

EC number:

Alternative names:(Neighbor of COX4)

Cleaved into:

GeneID:18117

Gene names  (primary ):Emc8

Gene names  (synonym ):Cox4al Cox4nb Noc4

Gene names  (ORF ):

Length:207

Mass:23348

Sequence:MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAERQRPRKEHPPGAGSHTLFVDCIPLFHGTLALTPMLEVALTLIDSWCKDNSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFGDAALIMVDNAKFTMDCAAPTIHVYEQHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRSDWTNPEINKAVLHLC

Tissue specificity:

Induction:

Developmental stage:

Protein families:EMC8/EMC9 family


   💬 WhatsApp