UB2FB_MOUSE   Q3UWQ3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3UWQ3

Recommended name:NEDD8-conjugating enzyme UBE2F-B

EC number:EC 2.3.2.34

Alternative names:(NEDD8 carrier protein UBE2F-B) (NEDD8 protein ligase UBE2F-B) (RING-type E3 NEDD8 transferase UBE2F-B) (Ubiquitin-conjugating enzyme E2 F-B)

Cleaved into:

GeneID:

Gene names  (primary ):Ube2fb

Gene names  (synonym ):Gm5434

Gene names  (ORF ):

Length:185

Mass:21352

Sequence:MLTLASKLKWDEDLKGSQTSVSTSDSTRRFSMRDKLLVTEVAELEANLPWTCKVHFPDPNKLHCFQLTVSPDEGYYQGGNFQFEIEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSADGTGWAPTRTLKDVVWGLNSLFTDLLNFYDPLNIEAAEHHLQDKEDFRDKVDEYIRRYAR

Tissue specificity:

Induction:

Developmental stage:

Protein families:Ubiquitin-conjugating enzyme family, UBE2F subfamily


   💬 WhatsApp