RNF11_MOUSE   Q9QYK7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QYK7

Recommended name:RING finger protein 11

EC number:

Alternative names:(NEDD4 WW domain-binding protein 2) (Sid 1669)

Cleaved into:

GeneID:29864

Gene names  (primary ):Rnf11

Gene names  (synonym ):N4wbp2 Sid1669

Gene names  (ORF ):

Length:154

Mass:17458

Sequence:MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPIYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp