BY55_MOUSE O88875
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88875
Recommended name：CD160 antigen
EC number：
Alternative names：(Natural killer cell receptor BY55) (CD antigen CD160)
Cleaved into：CD160 antigen, soluble form
GeneID：54215
Gene names (primary )：Cd160
Gene names (synonym )：By55
Gene names (ORF )：
Length：185
Mass：20570
Sequence：MQRILMAPGQSCCALAILLAIVNFQHGGCIHVTSSASQKGGRLDLTCTLWHKKDEAEGLILFWCKDNPWNCSPETNLEQLRVKRDPETDGITEKSSQLVFTIEQATPSDSGTYQCCARSQKPEIYIHGHFLSVLVTGNHTEIRQRQRSHPDFSHINGTLSSGFLQVKAWGMLVTSLVALQALYTL
Tissue specificity：Expressed in resting and activated NK cell subsets (at protein level) (PubMed:25711213, PubMed:16177084). Expressed in resting NKT cells (at protein level) (PubMed:16177084). Expressed in activated CD8+ T cells (at protein level). Highly expressed in intraepithelial lymphocyte (IEL) subsets, particularly in innate-like CD8A-positive IELs (at protein level) (PubMed:22801499). {ECO:0000269|PubMed:16177084, ECO:0000269|PubMed:22801499, ECO:0000269|PubMed:25711213}.
Induction：
Developmental stage：
Protein families：