NACC1_MOUSE   Q7TSZ8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TSZ8

Recommended name:Nucleus accumbens-associated protein 1

EC number:

Alternative names:(NAC-1) (BTB/POZ domain-containing protein 14B)

Cleaved into:

GeneID:66830

Gene names  (primary ):Nacc1

Gene names  (synonym ):Btbd14b Nac1

Gene names  (ORF ):

Length:514

Mass:56537

Sequence:MAQTLQMEIPNFGNSILECLNEQRLQGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLFNSSRSAVVELPAAVQPQSFQQILTFCYTGRLSMNMGDQFLLIYTAGFLQIQEIMEKGTEFFLKVSSPSCDSQGLHPEEAPSSEPQSPVAQTLGWPACSTPLPLVSRVKTEQELDSVQCTPMAKRLWDSSQKEAGGSGGNNGSRKMAKFSTPDLALNRMPQPLSMATATAAVAVVAVGGCVSGPSMSERTSPGTSSAYTSDSPSSYHNEEDEEEDAGEEGTDEQYRQICNMYTMYSMLNVGQTAEKVEALPEQVVLESRSRIRVRQDLASLPAELINQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWLPKTKPLHLVEGDNYSSFISDTCKIEPDMMSMEHSFETASHDGEAGPSAEVLQ

Tissue specificity:Ubiquitously expressed with higher expression in the brain, kidney and liver, and at lower levels in heart, lung and testes. {ECO:0000269|PubMed:14521994}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp