NKAI3_MOUSE Q3URJ8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3URJ8
Recommended name：Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3
EC number：
Alternative names：(Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 3) (Protein FAM77D)
Cleaved into：
GeneID：269513
Gene names (primary )：Nkain3
Gene names (synonym )：Fam77d
Gene names (ORF )：
Length：181
Mass：20700
Sequence：MGCCTGRCSLVCLCALQLLSALERQIFDFLGFQWAPILGNFLHIIVVILGLFGTIQYRPRYIMVYTVWTALWVTWNVFIICFYLEVGGLSKDTDLMTFNISVHRSWWREHGPGCVRRVLPPSAHGMMDDYTYVSVTGCVVDFQYLEVIHSAVQILLSLVGFVYACYVISISMEEEDTCRNK
Tissue specificity：Detected in the brain only and specifically in neurons. Expressed in multiple regions such as cerebral cortex, thalamus, hippocampus, olfactory bulb and brainstem as well as in cerebellum with low expression in granular cell layer. {ECO:0000269|PubMed:17606467}.
Induction：
Developmental stage：
Protein families：NKAIN family