MUP17_MOUSE B5X0G2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:B5X0G2
Recommended name：Major urinary protein 17
EC number：
Alternative names：(MUP 17)
Cleaved into：
GeneID：100039206
Gene names (primary )：Mup17
Gene names (synonym )：Mup15
Gene names (ORF )：
Length：180
Mass：20638
Sequence：MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEEHGNFRLFLEQIHVLENSLVLKVHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
Tissue specificity：Because of their involvement in the coordination of social behavior, Mup proteins are thought to exhibit variable expression depending upon gender, age and status of the studied individuals. Expression may also be strain-specific: in strains C57BL/6J and 129S7, transcriptional support is lacking for Mup17. {ECO:0000269|PubMed:18507838}.
Induction：
Developmental stage：
Protein families：Calycin superfamily, Lipocalin family