RT34_MOUSE   Q9JIK9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JIK9

Recommended name:28S ribosomal protein S34, mitochondrial

EC number:

Alternative names:(MRP-S34) (S34mt) (T-complex expressed gene 2 protein)

Cleaved into:

GeneID:79044

Gene names  (primary ):Mrps34

Gene names  (synonym ):Tce2

Gene names  (ORF ):

Length:218

Mass:25827

Sequence:MARKKVRPRLIAELARRVRALREQRNQPRDSQLYALDYETLTRPHSGRRLPVRAWADVRRESRLLQLLARLPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYTAQNLDHGRAWGILTFKGKSEDTAREIEQVMYHDWRLVPKHEEEAFTAFTAKPEDRLNSVPYPPLLRAMILAERQKNGDTSVQEPLLNLERTRMRPWDYPAKQETKGRAKGTPV

Tissue specificity:Widely expressed (at protein liver). {ECO:0000269|PubMed:25816300}.

Induction:

Developmental stage:

Protein families:Mitochondrion-specific ribosomal protein mS34 family


   💬 WhatsApp