RT26_MOUSE   Q80ZS3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q80ZS3

Recommended name:28S ribosomal protein S26, mitochondrial

EC number:

Alternative names:(MRP-S26) (S26mt)

Cleaved into:

GeneID:99045

Gene names  (primary ):Mrps26

Gene names  (synonym ):

Gene names  (ORF ):

Length:200

Mass:23444

Sequence:MLRALNRLAARPETRPPTPLLLPVRGRKTRHDPPAKSKVGRVQTPPAVDPAEFFVLTERYRQYRETVRALRLEFTLEVRRKLHEARAGVLAERKAQQAITEHRELMAWNRDENRRMQELRIARLQLEAQAQEVQKAEAQAQRAQEEQAWVQLKEQEVLKLQEEAKNFITRENLEARIEEALDSPKSYNWAVTKEGQVVRN

Tissue specificity:

Induction:

Developmental stage:

Protein families:Mitochondrion-specific ribosomal protein mS26 family


   💬 WhatsApp