MPV17_MOUSE P19258
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P19258
Recommended name：Protein Mpv17
EC number：
Alternative names：(Mpv-17)
Cleaved into：
GeneID：17527
Gene names (primary )：Mpv17
Gene names (synonym )：
Gene names (ORF )：
Length：176
Mass：19686
Sequence：MALWRAYQRALAAHPWKVQVLTAGSLMGVGDMISQQLVERRGLQQHQAGRTLTMVSLGCGFVGPVVGGWYKVLDHLIPGTTKVHALKKMLLDQGGFAPCFLGCFLPLVGILNGMSAQDNWAKLKRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAIVWNSYLSWKAHQF
Tissue specificity：High levels in heart, kidney, and brain, intermediate levels in testis, and low levels in liver and spleen.
Induction：
Developmental stage：
Protein families：Peroxisomal membrane protein PXMP2/4 family