PGRC1_MOUSE   O55022


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O55022

Recommended name:Membrane-associated progesterone receptor component 1

EC number:

Alternative names:(mPR)

Cleaved into:

GeneID:53328

Gene names  (primary ):Pgrmc1

Gene names  (synonym ):Pgrmc

Gene names  (ORF ):

Length:195

Mass:21694

Sequence:MAAEDVVATGADPSELEGGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLSDWDSQFTFKYHHVGKLLKEGEEPTVYSDDEEPKDETARKNE

Tissue specificity:

Induction:

Developmental stage:

Protein families:Cytochrome b5 family, MAPR subfamily


   💬 WhatsApp