PAQR5_MOUSE   Q9DCU0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DCU0

Recommended name:Membrane progestin receptor gamma

EC number:

Alternative names:(mPR gamma) (Membrane progesterone P4 receptor gamma) (Membrane progesterone receptor gamma) (Progesterone and adipoQ receptor family member 5) (Progestin and adipoQ receptor family member 5) (Progestin and adipoQ receptor family member V)

Cleaved into:

GeneID:74090

Gene names  (primary ):Paqr5

Gene names  (synonym ):Mprg

Gene names  (ORF ):

Length:330

Mass:38151

Sequence:MLSLKLPRLFRIDQVPQVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFVWRFMTALYVTDIQNDSYSWPMLVYMCTSCVYPLASSCAHTFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTFPDALVCSTFHECYVALAVLNTILSTGLSCYSRFLELQKPRLCKLLRVLAFAYPYTWDSLPIFYRLFLFPGESSRNEAMLYHQKHMGMTLLASFFYSAHLPERLAPGRFDYIGHSHQLFHVCVILATHLQMEAILLDKTLRREWLLATSRPFSFPQIAAAMLLCIIFSLSNIIYFSAALYRIPEPELHEKET

Tissue specificity:

Induction:

Developmental stage:

Protein families:ADIPOR family


   💬 WhatsApp