PAQR6_MOUSE   Q6TCG5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6TCG5

Recommended name:Membrane progestin receptor delta

EC number:

Alternative names:(mPR delta) (Membrane progesterone P4 receptor delta) (Membrane progesterone receptor delta) (Progesterone and adipoQ receptor family member 6) (Progestin and adipoQ receptor family member 6) (Progestin and adipoQ receptor family member VI)

Cleaved into:

GeneID:68957

Gene names  (primary ):Paqr6

Gene names  (synonym ):

Gene names  (ORF ):

Length:343

Mass:38176

Sequence:MLSLKMPQLLRVHQVPRVFWEEGIMSGYRCPTSSALDCVLSSFQMTNETVNIWTHFLPTWYFLWRLLALGSPGFRADPYHLPLLVFLLPACLYPFASCCAHTFSSMSPRARHICYFLDYGALSLYSLGCAFPYAAYSMPASWLHSRLHQLFVPAAALNSFLCTGLSCYSRFPELEYPGFSKALRTAAFAYPFLFDNLPLFYRLRLCWGGAHSCGRDALSSNHGYHLLCALLSGFLFAARLPERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADMGSRRAWLAVQEPTLGLGATVATLSLAVIGNLFIIAAFTASLLRMPGPCPLLQGSPLEEGLQAKQQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:ADIPOR family


   💬 WhatsApp