ISK4_MOUSE   O35679


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35679

Recommended name:Serine protease inhibitor Kazal-type 4

EC number:

Alternative names:(MPGC60 protein) (Peptide PEC-60 homolog)

Cleaved into:

GeneID:20731

Gene names  (primary ):Spink4

Gene names  (synonym ):Mpgc60

Gene names  (ORF ):

Length:86

Mass:9729

Sequence:MAMHLWLVTLTLVPLLGMDRELMVSAGSLVFPRMPFCEHMAELPNCPQTPNLICGTDGLTYENECHLCLTRMKTMKDIQIMKDGQC

Tissue specificity:Expressed in the intestinal tract.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp