VMAT2_MOUSE   Q8BRU6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BRU6

Recommended name:Synaptic vesicular amine transporter

EC number:

Alternative names:(Monoamine transporter) (Solute carrier family 18 member 2) (Vesicular amine transporter 2) (VAT2)

Cleaved into:

GeneID:214084

Gene names  (primary ):Slc18a2

Gene names  (synonym ):Vmat2

Gene names  (ORF ):

Length:517

Mass:55754

Sequence:MALSDLVLLRWLRDSRHSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNTTEIQTARPALTASTSESFHSIFSYYNNSTVFTGNATGGLPGGESPKATTTQHTVTNTTVPPDCPSEDKDLLNENVQVGLLFASKATVQLLTNPFIGLLTNRIGYPIPMFAGFCIMFISTVMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNAMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIVVGISILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDIVFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNNVQPYPVGDDEESESD

Tissue specificity:

Induction:

Developmental stage:

Protein families:Major facilitator superfamily, Vesicular transporter family


   💬 WhatsApp