MOC2A_MOUSE   Q9Z224


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z224

Recommended name:Molybdopterin synthase sulfur carrier subunit

EC number:

Alternative names:(Molybdenum cofactor synthesis protein 2 small subunit) (Molybdenum cofactor synthesis protein 2A) (MOCS2A) (Sulfur carrier protein MOCS2A)

Cleaved into:

GeneID:

Gene names  (primary ):Mocs2

Gene names  (synonym ):

Gene names  (ORF ):

Length:88

Mass:9745

Sequence:MVPRCQIDVLYFAKSAEIAGVRSETISVPQEIKASELWKELEMLHPGLADVRNQVIFAVRQEYVELGDQQLLLQPGDEVAIIPPISGG

Tissue specificity:

Induction:

Developmental stage:

Protein families:MoaD family, MOCS2A subfamily


   💬 WhatsApp