GP143_MOUSE P70259
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70259
Recommended name：G-protein coupled receptor 143
EC number：
Alternative names：(MOA1) (Ocular albinism type 1 protein homolog)
Cleaved into：
GeneID：18241
Gene names (primary )：Gpr143
Gene names (synonym )：Oa1
Gene names (ORF )：
Length：405
Mass：44564
Sequence：MASPRLGIFCCPTWDAATQLVLSFQPRVFHALCLGSGTLRLVLGLLQLLSGRRSVGHRAPATSPAASVHILRAATACDLLGCLGIVIRSTVWIAYPEFIENISNVNATDIWPATFCVGSAMWIQLLYSACFWWLFCYAVDVYLVIRRSAGRSTILLYHIMAWGLAVLLCVEGAVMLYYPSVSRCERGLDHAIPHYVTTYLPLLLVLVANPILFHKTVTSVASLLKGRKGVYTENERLMGAVIKTRFFKIMLVLIACWLSNIINESLLFYLEMQPDIHGGSLKRIQNAARTTWFIMGILNPAQGLLLSLAFYGWTGCSLDVHPPKMVIQWETMTASAAEGTYQTPVRSCVPHQNPRKVVCVGGHTSDEVLSILSEDSDASTVEIHTATGSCNIKEVDSISQAQGEL
Tissue specificity：
Induction：
Developmental stage：
Protein families：G-protein coupled receptor OA family