MCPT2_MOUSE   P15119


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P15119

Recommended name:Mast cell protease 2

EC number:EC 3.4.21.-

Alternative names:(mMCP-2) (EC 3.4.21.-)

Cleaved into:

GeneID:17225

Gene names  (primary ):Mcpt2

Gene names  (synonym ):

Gene names  (ORF ):

Length:244

Mass:26732

Sequence:MQALLFLMALLLPSGAGAEEIIGGVEAKPHSRPYMAYLKFTTKNGSKERCGGFLIAPQFVMTAAHCNGSEISVILGAHNINKNEPTQQIIKTEKTFVHPKFQYLSGFYDIMLLKLQKKAELNSDVDVISLPSSSDFIKPGKMCWTAGWGKTGKNNPLSVTLREVELRIMDQEACKDHSDYDYQLQVCAGSPTTSKSIGQGDSGGPLVCDSVAHGIASSYEAKAPAVFTRISYYLPWIYKVLKSK

Tissue specificity:Mucosal mast cells.

Induction:

Developmental stage:

Protein families:Peptidase S1 family, Granzyme subfamily


   💬 WhatsApp