MP17L_MOUSE Q99MS3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99MS3
Recommended name:Mpv17-like protein
EC number:
Alternative names:(M-LP)
Cleaved into:
GeneID:93734
Gene names (primary ):Mpv17l
Gene names (synonym ):
Gene names (ORF ):
Length:194
Mass:22180
Sequence:MASWWRAFPQAARRYPWPTNVLLYAGLFSAGDALQQRLRGGPADWRQTRRVATLAVTFHGNFNYVWLRLLERALPGRAPRTVLAKVLCDQTVGGPIALSAFYVGMSVLQGKDDIFLDLKQKFWNTYKSGLMYWPFVQLTNFSLVPVHWRTAYTGLCAFLWATFLCFSQQSGDGTLQSIFIFLRRKEASDKSPEK
Tissue specificity:Isoform 1 and isoform 3 are expressed in the kidney (at protein level). Isoform 1 is expressed in the kidney, spleen, heart, brain, lung and liver. Isoform 3 is expressed in the kidney. Isoform 1 and isoform 3 expression increase during development, reache their highest level in adulthood and decrease with aging. {ECO:0000269|PubMed:11327696, ECO:0000269|PubMed:12471025, ECO:0000269|PubMed:15541722}.
Induction:
Developmental stage:
Protein families:Peroxisomal membrane protein PXMP2/4 family