MLRA_MOUSE   Q9QVP4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QVP4

Recommended name:Myosin regulatory light chain 2, atrial isoform

EC number:

Alternative names:(MLC-2a) (MLC2a) (Myosin light chain 2a) (Myosin regulatory light chain 7)

Cleaved into:

GeneID:17898

Gene names  (primary ):Myl7

Gene names  (synonym ):Mylc2a

Gene names  (ORF ):

Length:175

Mass:19450

Sequence:MASRKAGTRGKAAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKSDLKETYSQLGRVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGQGVVNKEEFKQLLMTQADKFSPAEVEQLFALTPMDLAGNIDYKSLCYIITHGDEKEE

Tissue specificity:Predominantly expressed in adult atrial muscle. {ECO:0000269|PubMed:8207020}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp