MYL4_MOUSE   P09541


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P09541

Recommended name:Myosin light chain 4

EC number:

Alternative names:(MLC1EMB) (Myosin light chain 1, atrial/fetal isoform) (MLC1A)

Cleaved into:

GeneID:

Gene names  (primary ):Myl4

Gene names  (synonym ):Mlc1a Myla

Gene names  (ORF ):

Length:193

Mass:21159

Sequence:MPPKKPEPKKEAAKPAAAPAPAASAAPEPLKDSAFDPKSVKIDFSADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMSSKTLDFEMFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMSEAEVEQLLSGQEDANGCINYEAFVKHIMSG

Tissue specificity:Expressed in atrial muscle and in fetal skeletal and ventricular muscle.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp