SYPL2_MOUSE   O89104


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O89104

Recommended name:Synaptophysin-like protein 2

EC number:

Alternative names:(Mitsugumin-29) (Mg29)

Cleaved into:

GeneID:17306

Gene names  (primary ):Sypl2

Gene names  (synonym ):Mg29

Gene names  (ORF ):

Length:264

Mass:29224

Sequence:MSSTESPGRTSDKSPRQQVDRLLLGLRWQRLEEPLGFIKVLQWLFAIFAFGSCGSYSGETGALVLCNNEAKDVSSIIVLFGYPFRLYQVQYEMPLCDQDSTSKTMNLMGDFSAPAEFFVTLGIFSFFYTMAALVIYLRFHKLYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKGATRPSSLTAAMSVCHGEEAVCSAGATPSMGLANLSVLFGFINFFLWAGNCWFVFKETPWHGQGQDQGQGPSQESAAEQGAVEKQ

Tissue specificity:Expressed abundantly in skeletal muscle and at lower levels in the kidney. {ECO:0000269|PubMed:9708916}.

Induction:

Developmental stage:

Protein families:Synaptophysin/synaptobrevin family


   💬 WhatsApp