MD2L2_MOUSE   Q9D752


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D752

Recommended name:Mitotic spindle assembly checkpoint protein MAD2B

EC number:

Alternative names:(Mitotic arrest deficient 2-like protein 2) (MAD2-like protein 2)

Cleaved into:

GeneID:71890

Gene names  (primary ):Mad2l2

Gene names  (synonym ):Mad2b Rev7

Gene names  (ORF ):

Length:211

Mass:24402

Sequence:MTTLTRQDLNFGQVVADVLSEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSINSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKNS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp