CISD1_MOUSE   Q91WS0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91WS0

Recommended name:CDGSH iron-sulfur domain-containing protein 1

EC number:

Alternative names:(MitoNEET)

Cleaved into:

GeneID:52637

Gene names  (primary ):Cisd1

Gene names  (synonym ):D10Ertd214e Zcd1

Gene names  (ORF ):

Length:108

Mass:12097

Sequence:MGLSSNSAVRVEWIAAVTFAAGTAALGYLAYKKFYAKENRTKAMVNLQIQKDNPKVVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHIKHNEETGDNVGPLIIKKKET

Tissue specificity:Liver, adipose, skeletal muscle and heart (at protein level). Widely expressed. Expressed at the highest levels in the heart. {ECO:0000269|PubMed:17376863}.

Induction:

Developmental stage:

Protein families:CISD protein family


   💬 WhatsApp