MFRN2_MOUSE   Q8R0Z5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R0Z5

Recommended name:Mitoferrin-2

EC number:

Alternative names:(Mitochondrial RNA-splicing protein 3/4 homolog) (MRS3/4) (Mitochondrial iron transporter 2) (Solute carrier family 25 member 28)

Cleaved into:

GeneID:246696

Gene names  (primary ):Slc25a28

Gene names  (synonym ):Mfrn2

Gene names  (ORF ):

Length:364

Mass:39358

Sequence:MELEGRSAGGVAGGPAAGPGRSPGESALLDGWLQRGVGRGAGGGEAGAYQPPVRLDPESGPEYEALPAGATVTTHMVAGAVAGILEHCVMYPIDCVKTRMQSLQPDPAARYRNVLEALWRIMRTEGLWRPMRGLNVTATGAGPAHALYFACYEKLKKTLSDVIHPGGNSHIANGAAGCVATLLHDAAMNPAEVVKQRMQMYNSPYHRVTDCVRAVWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSHVLCGACAGAVAAAATTPLDVCKTLLNTQESLALNSNITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPSTAIAWSVYEFFKYLITKRQEEWRAGK

Tissue specificity:Ubiquitously expressed at low level. Expressed at higher level in heart, liver, kidney and testis. Expression does not vary during erythroid maturation. {ECO:0000269|PubMed:11297739, ECO:0000269|PubMed:16511496}.

Induction:

Developmental stage:

Protein families:Mitochondrial carrier (TC 2.A.29) family


   💬 WhatsApp