T10B_MOUSE Q9WV96
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WV96
Recommended name：Mitochondrial import inner membrane translocase subunit Tim10 B
EC number：
Alternative names：(Mitochondrial import inner membrane translocase subunit Tim9 B) (TIMM10B) (Tim10b)
Cleaved into：
GeneID：14356
Gene names (primary )：Timm10b
Gene names (synonym )：Fxc1 Tim9b Timm9b
Gene names (ORF )：
Length：100
Mass：11314
Sequence：MEQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVHLMPALVQRRIADYEAASAAPGIPAEQTRDSPSGS
Tissue specificity：
Induction：
Developmental stage：
Protein families：Small Tim family