MID49_MOUSE   Q5NCS9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5NCS9

Recommended name:Mitochondrial dynamics protein MID49

EC number:

Alternative names:(Mitochondrial dynamics protein of 49 kDa homolog) (Mitochondrial elongation factor 2) (Smith-Magenis syndrome chromosomal region candidate gene 7 protein homolog)

Cleaved into:

GeneID:237781

Gene names  (primary ):Mief2

Gene names  (synonym ):Gm11 Mid49 Smcr7

Gene names  (ORF ):

Length:454

Mass:49624

Sequence:MAEFSQKQRKQSGSEGLGSVVDFLLANARLVLGVGGAAVLGIATLAVKRLIDRATSPPDEDDTKGDSWKELSLLRATSPQKPQPPPAAFSQPLATGSPSPSVPVEPTPIHSPTTPKFSTIAPLCLTFQERLLAFERKHVITPEAHVTLAKQLAGDIALELQAYLRSKFPELPFGALVPGGPLYDGLQAGTAEHVRLLAPLELEPGLWSLVPGVDTVAREPRCWAVRRTQLEFHPRGCSPWDRFLVGGYLSSRVLLELLRKALSASVNWPAIGSLLGCLIWPDVASEELLLKVQHECLEFTLAVLMVVPGASTDDRLLLAWPLEGLASNLWLQDLYPVETARLRALDDQDAGTRRRLLLLLCGICRGHPALVRLGWSHLTQVVLHLGEEEVAWTEEALGERFLQALEFLVGSLEQASLPCHFNPSVNLLGNFREEEIDDIGYVLYSGLQVPESLF

Tissue specificity:

Induction:

Developmental stage:

Protein families:MID49/MID51 family


   💬 WhatsApp