MID49_MOUSE Q5NCS9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5NCS9
Recommended name：Mitochondrial dynamics protein MID49
EC number：
Alternative names：(Mitochondrial dynamics protein of 49 kDa homolog) (Mitochondrial elongation factor 2) (Smith-Magenis syndrome chromosomal region candidate gene 7 protein homolog)
Cleaved into：
GeneID：237781
Gene names (primary )：Mief2
Gene names (synonym )：Gm11 Mid49 Smcr7
Gene names (ORF )：
Length：454
Mass：49624
Sequence：MAEFSQKQRKQSGSEGLGSVVDFLLANARLVLGVGGAAVLGIATLAVKRLIDRATSPPDEDDTKGDSWKELSLLRATSPQKPQPPPAAFSQPLATGSPSPSVPVEPTPIHSPTTPKFSTIAPLCLTFQERLLAFERKHVITPEAHVTLAKQLAGDIALELQAYLRSKFPELPFGALVPGGPLYDGLQAGTAEHVRLLAPLELEPGLWSLVPGVDTVAREPRCWAVRRTQLEFHPRGCSPWDRFLVGGYLSSRVLLELLRKALSASVNWPAIGSLLGCLIWPDVASEELLLKVQHECLEFTLAVLMVVPGASTDDRLLLAWPLEGLASNLWLQDLYPVETARLRALDDQDAGTRRRLLLLLCGICRGHPALVRLGWSHLTQVVLHLGEEEVAWTEEALGERFLQALEFLVGSLEQASLPCHFNPSVNLLGNFREEEIDDIGYVLYSGLQVPESLF
Tissue specificity：
Induction：
Developmental stage：
Protein families：MID49/MID51 family