TOM20_MOUSE Q9DCC8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DCC8
Recommended name：Mitochondrial import receptor subunit TOM20 homolog
EC number：
Alternative names：(Mitochondrial 20 kDa outer membrane protein) (Outer mitochondrial membrane receptor Tom20)
Cleaved into：
GeneID：67952
Gene names (primary )：Tomm20
Gene names (synonym )：
Gene names (ORF )：
Length：145
Mass：16284
Sequence：MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Tissue specificity：Expressed in brain, kidney, stomach, colon, jejunum, ileum, testis, ovary and oviduct (at protein level) (PubMed:19492028). In the brain, expressed in neural cells of the cerebrum and cerebellum (at protein level) (PubMed:19492028). In the kidney, expressed in the proximal to distal tubule in the cortex and the outer and inner zones of the medulla (at protein level) (PubMed:19492028). In the stomach, expressed in the basal layer of stratified squamous epithelia in the forestomach and in the gastric pit and fundic gland of the glandular stomach (at protein level) (PubMed:19492028). Expressed in epithelial cells of the jejunum, ileum, and colon (at protein level) (PubMed:19492028). In the testis, expressed by spermatocytes and spermatogonia (at protein level) (PubMed:19492028). In the ovaries, expressed by follicular epithelial cells and corpus luteum cells (at protein level) (PubMed:19492028). In the oviduct, expressed in the epithelia of the isthmus and the ciliated cells of the ampulla (at protein level) (PubMed:19492028). {ECO:0000269|PubMed:19492028}.
Induction：
Developmental stage：
Protein families：Tom20 family