TFB1M_MOUSE   Q8JZM0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8JZM0

Recommended name:Dimethyladenosine transferase 1, mitochondrial

EC number:EC 2.1.1.-

Alternative names:(Mitochondrial 12S rRNA dimethylase 1) (Mitochondrial transcription factor B1) (mtTFB1) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase 1)

Cleaved into:

GeneID:224481

Gene names  (primary ):Tfb1m

Gene names  (synonym ):

Gene names  (ORF ):

Length:345

Mass:38962

Sequence:MAASGKLGTFRLPPLPTIREIIKLFGLRAVKQLSQNFLLDLRLTDKIVRKAGSLADVYVYEVGPGPGGITRSILNANVAELLVVEKDTRFIPGLQMLSDAAPGKLRIVHGDVLTYKIEKAFPGNIRRQWEDDPPNVHIIGNLPFSVSTPLIIKWLENISLKDGPFVYGRTKMTLTFQKEVAERLVATTGSKQHSRLSIMAQYLCNVEHLFTIPGKAFVPKPKVDVGVVHLTPLIEPKIKQPFKLVEKVVQNAFQFRRKYCHRGLGMLFPEAQRLESTGRLLQLADIDPTLRPTHLSLMHFKSLCDVYRKMCDEDPQLFTYNFREELKQKKSKGQEKDGDPESCGF

Tissue specificity:Ubiquitously expressed. {ECO:0000269|PubMed:12532263}.

Induction:

Developmental stage:

Protein families:Class I-like SAM-binding methyltransferase superfamily, rRNA adenine N(6)-methyltransferase family, KsgA subfamily


   💬 WhatsApp