KCNE5_MOUSE Q9QZ26
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QZ26
Recommended name：Potassium voltage-gated channel subfamily E regulatory beta subunit 5
EC number：
Alternative names：(MinK-like protein) (Potassium voltage-gated channel subfamily E member 1-like protein)
Cleaved into：
GeneID：66240
Gene names (primary )：Kcne5
Gene names (synonym )：Kcne1l
Gene names (ORF )：
Length：143
Mass：14968
Sequence：MNCSESQRLQTLLNRLLLELHHRGNASGLGIGTGPSMGMGVVPDPFVGREATSAKGNDAYLYILLIMIFYACLAGGLILAYTRSRKLVEAKDEPPLACVAEQEWVPAAIASADPENGQGLLAEGGHQLAAGALPALAQGAERV
Tissue specificity：Detected in embryonal dorsal root and nerve ganglia, in the somites and in myoepicardial layer of the developing heart wall. Detected at lower levels in the central nervous system (CNS) and in developing limb. {ECO:0000269|PubMed:10493825}.
Induction：
Developmental stage：
Protein families：Potassium channel KCNE family