MET14_MOUSE   Q3UIK4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3UIK4

Recommended name:N6-adenosine-methyltransferase non-catalytic subunit

EC number:

Alternative names:(Methyltransferase-like protein 14)

Cleaved into:

GeneID:210529

Gene names  (primary ):Mettl14

Gene names  (synonym ):Kiaa1627

Gene names  (ORF ):

Length:456

Mass:52122

Sequence:MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNSKRKCLDEGETDEDKVEEYKDELEMQQEEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGTHRGGFTPR

Tissue specificity:Expressed in testis (PubMed:28914256). Highly expressed in radial glial cells during embryonic cortical neurogenesis (PubMed:28965759). {ECO:0000269|PubMed:28914256, ECO:0000269|PubMed:28965759}.

Induction:

Developmental stage:

Protein families:MT-A70-like family


   💬 WhatsApp