MBD1_MOUSE Q9Z2E2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z2E2
Recommended name：Methyl-CpG-binding domain protein 1
EC number：
Alternative names：(Methyl-CpG-binding protein MBD1)
Cleaved into：
GeneID：17190
Gene names (primary )：Mbd1
Gene names (synonym )：
Gene names (ORF )：
Length：636
Mass：70023
Sequence：MAESWQDCPALGPGWKRRESFRKSGASFGRSDIYYQSPTGEKIRSKVELTRYLGPACDLTLFDFRQGTLCHPIPKTHPLAVPSKKKKKPSKPAKTKKQQVGLQRSEVRIETPQGEYKAPTATALASLSVSASASSSASASASASSHAPVCCENCGIHFSWDGVKRQRLKTLCKDCRAQRIAFNREQRMFKRVGCGDCAACLVKEDCGVCSTCRLQLPSDVASGLYCKCERRRCLRIMEKSRGCGVCRGCQTQEDCGHCCICLRSPRPGLKRQWRCLQRRCFWGKRDSSKRGSKVASQRHSQAPPLPPHPASQYTEPTELHISDIAPTSPAEFIYYCVDEDEDELQPYTNQRQNRKCGACAACLRRMDCGRCDFCCDKPKFGGGNQKRQKCRWRQCLQFAMKRLLPSAGSGSGEGAGLRPYQTHQTHQKRPASARQLQLSSPLKAPWAVVTAPPGPVRDSRKQQAGRGSVLPQPDTDFVFLQEGTSSAMQMPGTAAASTEVPVQAAQCSAPSWVVALPQVKQETADAPEEWTAVTTFLTSSTLQSGFPSKAADPDLSPVKQEPPGPEEDGEEKKDDVSETTPAEEIGGVGTPVITEIFSLGGTRLRDAEAWLPRLHKLLAVNEKEYFTELQLKEEVL
Tissue specificity：Highly expressed in kidney, liver and brain. Detected at lower levels in heart, lung, skeletal muscle, spleen and testis. {ECO:0000269|PubMed:9774669}.
Induction：
Developmental stage：
Protein families：