TAC2N_MOUSE   Q91XT6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91XT6

Recommended name:Tandem C2 domains nuclear protein

EC number:

Alternative names:(Membrane targeting tandem C2 domain-containing protein 1) (Tandem C2 protein in nucleus) (Tac2-N)

Cleaved into:

GeneID:74413

Gene names  (primary ):Tc2n

Gene names  (synonym ):Mtac2d1

Gene names  (ORF ):

Length:489

Mass:54988

Sequence:MAAEFIKSCCRGCLYGETEKQKFSVDRDFKASASSSQNTIGIPPLTSVLVKPQVGCNEDYLLSKLPCDGKEVQFVVPRFKLSYIQPRTQGIPSHLDELEGSARASFGDQKTELCSSFYHGPSYDVYNPCYMYQHFSPDLSRRFLPHCETKQLYGSVCDLRTSKLPGSSGLSKSMLDLTTSSQRFIQRHDSFSSVPSSSSSRKNSQGSNRSLDTITLSGDERDLGRLNVKLFYNSSAEQIWITVLQCRDISWPSSYGDTPTISIKGILTLSKPVHFKSSAKEGSNAIEFMETFVFAIKLQNLQAVRLAFKIQTQTPKKKTIGECSLSLRTLSTQEMEYSLEIIAPSKISVCQAELELGTCFQAVNSRIQLQILEAQYLPSSSTPLTLSFFVKVGMFSSGELIYKKKTRLLKASSGRVKWGETMIFPLIQTEKEIVFLIKLYSRSSVRRKHFVGQLWISEDSNNIEAVNQWKETITNPEKVVIKWHKLNPS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp