S45A2_MOUSE P58355
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P58355
Recommended name：Membrane-associated transporter protein
EC number：
Alternative names：(Melanoma antigen AIM1) (Protein AIM-1) (Protein underwhite) (Solute carrier family 45 member 2)
Cleaved into：
GeneID：22293
Gene names (primary )：Slc45a2
Gene names (synonym )：Aim1 Matp uw
Gene names (ORF )：
Length：530
Mass：57961
Sequence：MSGSNGPTDTHTYQSLAEDCPFGSVEQPKRSTGRLVMHSMAMFGREFCYAVEAAYVTPVLLSVGLPKSLYSMVWLLSPILGFLLQPVVGSASDHCRARWGRRRPYILTLAIMMLLGMALYLNGDAVVSALVANPRQKLIWAISITMVGVVLFDFSADFIDGPIKAYLFDVCSHQDKEKGLHYHALFTGFGGALGYILGAIDWVHLDLGRLLGTEFQVMFFFSALVLILCFITHLCSIPEAPLRDAATDPPSQQDPQGSSLSASGMHEYGSIEKVKNGGADTEQPVQEWKNKKPSGQSQRTMSMKSLLRALVNMPSHYRCLCVSHLIGWTAFLSNMLFFTDFMGQIVYHGDPYGAHNSTEFLIYERGVEVGCWGLCINSVFSSVYSYFQKAMVSYIGLKGLYFMGYLLFGLGTGFIGLFPNVYSTLVLCSMFGVMSSTLYTVPFNLIAEYHREEEKEKGQEAPGGPDNQGRGKGVDCAALTCMVQLAQILVGGGLGFLVNMAGSVVVVVITASAVSLIGCCFVALFVRYVD
Tissue specificity：Melanocytes, eyes, kidney and uterus.
Induction：
Developmental stage：
Protein families：Glycoside-pentoside-hexuronide (GPH) cation symporter transporter (TC 2.A.2) family