TPD52_MOUSE Q62393
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62393
Recommended name：Tumor protein D52
EC number：
Alternative names：(mD52)
Cleaved into：
GeneID：21985
Gene names (primary )：Tpd52
Gene names (synonym )：
Gene names (ORF )：
Length：224
Mass：24313
Sequence：MECRDMELADDYQSPFDFDSGVNKNYLYLSPSGNTSPPGSPTQNVGLLKTEPVAEEGEDAVTMLSAPEALTEEEQEELRRELTKVEEEIQTLSQVLAAKEKHLAELKRKLGISSLQEFKQNIAKGWQDVTATNAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGAKPAGGDFGEVLNSTANATSTMTTEPPPEQMTESP
Tissue specificity：Isoform 2 is expressed at higher levels in kidney and brain than in liver, lung, testis and heart. Within the brain, isoform 2 is highly expressed in the granular layer of the cerebellum, the cortex and the hippocampus. In embryos, isoform 2 is expressed in the epithelium of the developing intestine, stomach, olfactory epithelium, neuronal layers of the retina, salivary gland, kidney and dorsal root ganglion. {ECO:0000269|PubMed:8632896}.
Induction：
Developmental stage：
Protein families：TPD52 family