MBL1_MOUSE P39039
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P39039
Recommended name：Mannose-binding protein A
EC number：
Alternative names：(MBP-A) (Mannan-binding protein) (Ra-reactive factor polysaccharide-binding component p28B) (RaRF p28B)
Cleaved into：
GeneID：17194
Gene names (primary )：Mbl1
Gene names (synonym )：
Gene names (ORF )：
Length：239
Mass：25396
Sequence：MLLLPLLPVLLCVVSVSSSGSQTCEDTLKTCSVIACGRDGRDGPKGEKGEPGQGLRGLQGPPGKLGPPGSVGSPGSPGPKGQKGDHGDNRAIEEKLANMEAEIRILKSKLQLTNKLHAFSMGKKSGKKLFVTNHEKMPFSKVKSLCTELQGTVAIPRNAEENKAIQEVATGIAFLGITDEATEGQFMYVTGGRLTYSNWKKDEPNNHGSGEDCVIILDNGLWNDISCQASFKAVCEFPA
Tissue specificity：Detected in liver and blood serum (at protein level) (PubMed:1637828, PubMed:25419660). Detected in liver (PubMed:1712818). {ECO:0000269|PubMed:1637828, ECO:0000269|PubMed:1712818, ECO:0000269|PubMed:25419660}.
Induction：
Developmental stage：
Protein families：