MARC2_MOUSE   Q922Q1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q922Q1

Recommended name:Mitochondrial amidoxime reducing component 2

EC number:EC 1.7.-.-

Alternative names:(mARC2) (Molybdenum cofactor sulfurase C-terminal domain-containing protein 2) (MOSC domain-containing protein 2) (Moco sulfurase C-terminal domain-containing protein 2)

Cleaved into:

GeneID:67247

Gene names  (primary ):Mtarc2

Gene names  (synonym ):Marc2 Mg87 Mosc2

Gene names  (ORF ):

Length:338

Mass:38194

Sequence:MGSSSSTALARLGLPGQPRSTWLGVAALGLAAVALGTVAWRRTRPRRRRQLQQVGTVSKVWIYPIKSCKGVSVCETECTDMGLRCGKVRDRFWMVVKEDGHMVTARQEPRLVLVSITLENNYLTLEAPGMEQIVLPIKLPSSNKIHNCRLFGLDIKGRDCGDEVAQWFTNYLKTQAYRLVQFDTSMKGRTTKKLYPSESYLQNYEVAYPDCSPVHLISEASLVDLNTRLKKKVKMEYFRPNIVVSGCEAFEEDTWDELLIGDVEMKRVLSCPRCVLTTVDPDTGIIDRKEPLETLKSYRLCDPSVKSIYQSSPLFGMYFSVEKLGSLRVGDPVYRMVD

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp