MARC1_MOUSE   Q9CW42


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CW42

Recommended name:Mitochondrial amidoxime-reducing component 1

EC number:EC 1.7.-.-

Alternative names:(mARC1) (Molybdenum cofactor sulfurase C-terminal domain-containing protein 1) (MOSC domain-containing protein 1) (Moco sulfurase C-terminal domain-containing protein 1)

Cleaved into:

GeneID:66112

Gene names  (primary ):Mtarc1

Gene names  (synonym ):Marc1 Mosc1

Gene names  (ORF ):

Length:340

Mass:37979

Sequence:MGAGSWALTLFGFSAFRVPGQPRSTWLGVAALGLAAVALGTVAWRRARPRRRRRLQQVGTVAQLWIYPIKSCKGLSVSEAECTAMGLRYGHLRDRFWLVINEEGNMVTARQEPRLVLISLTCEDDTLTLSAAYTKDLLLPITPPATNPLLQCRVHGLEIQGRDCGEDAAQWVSSFLKMQSCRLVHFEPHMRPRSSRQMKAVFRTKDQVAYSDASPFLVLSEASLEDLNSRLERRVKATNFRPNIVISGCGVYAEDSWNEVLIGDVELKRVMACTRCLLTTVDPDTGISDRKEPLETLKSYRLCDPSEQALYGKLPIFGQYFALENPGTIRVGDPVYLLGQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp