MP2K3_MOUSE O09110
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O09110
Recommended name:Dual specificity mitogen-activated protein kinase kinase 3
EC number:EC 2.7.12.2
Alternative names:(MAP kinase kinase 3) (MAPKK 3) (MAPK/ERK kinase 3) (MEK 3)
Cleaved into:
GeneID:26397
Gene names (primary ):Map2k3
Gene names (synonym ):Mkk3 Prkmk3
Gene names (ORF ):
Length:347
Mass:39296
Sequence:MESPAASPPASLPQTKGKSKRKKDLRISCVSKPPVSNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNTQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLEKNMKIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADQFSPEFVDFTSQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
Tissue specificity:
Induction:
Developmental stage:
Protein families:Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase subfamily